Tag Archives: Web

Kanye West Wants You To Pay For Jesus & ‘Endgame’ Anticipation Boils: This Week’s Winners & Losers

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

More here:

Source: Splash News / Splash News Some things required a lot of prayer this week, and we’ll let you know what resulted in an L and what resulted in a miraculous win. Check out the losers for this week below, then hit the next page for the W! Losers 1. Kanye West’s $50 church socks  So these socks cost $50. If you bought these $50 Jesus socks from Kanye I’m just going to assume you also got scammed at Fyre Fest. pic.twitter.com/QvbTxWRyrY — sushi mane (@srkellz) April 21, 2019   A sock labeled “Church” costs $50. A sock labeled “Jesus” costs FIFTY DOLLARS. This past weekend, Kanye West performed at Coachella for his Sunday Service, which he would usually hold regularly for family and friends in the past. However, he decided to share the gospel-fused experience with Coachella, complete with a gospel choir, a sermon by DMX, and performances of Kanye hits like “Jesus Walks.” The whole event took place atop a man-made hill and everyone from Chance the Rapper to Donald Glover attended, according to TMZ . Now Kanye is already on thin ice for many of his fans, considering his MAGA love. But if the man wants to have a spiritual experience atop a grassy mountain with beige-tastic clothing, who’s to stop him? The issues came when Kanye was selling merchandise on site and the price tags were more than questionable. Kanye sold sweatshirts for $225, but considering his ideas about high fashion, this pricing might be SLIGHTLY comprehensible in a fashionista’s view. But when he charged $50 for socks…socks you walk in, socks that are sometimes covered up by jeans, he was completely and utterly tripping. And then, they have the nerve to have religious text on them, having me feel like I should pay $50 for Jesus when Jesus should be free… Or at least at an affordable price if you’re someone who puts money in religion. Twitter wasn’t haven’t it. Is this the #Easter miracle we’ve been waiting for?! $50 socks from Kanye. Do they help us walk on water? I need an honest review from someone at #Coachella . pic.twitter.com/DnUdbNJkFL — King B (@kuyakollective) April 21, 2019 Jesus ain’t died for some $50 socks or no $225 sweater, Kanye…SMH pic.twitter.com/zCvowCB3Zz — Reneé Larson (@iamreneejai) April 21, 2019 Jesus about to resurrect the dead to come beat the shit outta all the suckas that bought $50 Kanye socks — JLim (@JLimSD) April 21, 2019   No thanks Kanye. Moving on. 2. Avengers: Endgame spoilers I’ll make this one quick, since any utterance of an Endgame storyline could cause a riot. Endgame has arrived and we’ll finally learn the fate of the Avengers and the powerful Thanos. With the movie being hailed as a big rap-up for all 22 Marvel Universe movies, this is arguably the biggest flick of the year. So WHY DO PEOPLE HAVE TO SPOIL IT??? Spend one second on social media and you risk catching all the important stuff that will go down in history . This week, folks have been dodging spoilers left and right and they unleashed their grievances online. If you spoil endgame, i DEADASS won’t talk to you for a year and A HALF — dylan j. (@DYLANPHAMM) April 26, 2019   Things got pretty violent. Anyone who posting spoiler about Avengers or Game of Thrones deserves this #avengersendgame #GameofThrones pic.twitter.com/UayiVHWAQd — The Apostore (@theapostore) April 26, 2019 If you spoil Endgame for me and I know you cheating then your partner about to get a spoiler from me too lmao — Swaggy T (@Alexfromthe_H) April 25, 2019   But of course, folks who already saw the movie HAD to have jokes…to the point that “ Endgame spoiler without context” tweets started trending to poke fun at  Endgame deprived people. Avengers endgame spoiler : without context #AvengerEndgame pic.twitter.com/vlM7U6IABi — Olive oil (@Zoolhealme) April 26, 2019 Avengers Endgame out of context spoilers #Endgame #AvengersEndgame pic.twitter.com/Ux4MOvz4ng — M (@EmilyyCarrillo) April 26, 2019 Avengers: Endgame Spoilers w/o context #AvengersEngame #Endgame pic.twitter.com/DcOI35yLg4 — kamomile (@copkaaz) April 26, 2019   No shame. Get to the theaters before it’s too late.

Kanye West Wants You To Pay For Jesus & ‘Endgame’ Anticipation Boils: This Week’s Winners & Losers

→ Leave a comment

Posted in Celebrities, Hollywood, Hot Stuff, News

Tagged , , , , , , ,

Magic Johnson’s Daughter, Elisa, Left With “Intense Scarring” On Her Stomach After Airbnb Home Invasion [PHOTO]

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

See the original post here:

Source: Dan Jackman/WENN.com / WENN We are keeping Magic Johnson’s daughter, Elisa Johnson , in our prayers at this time. Back in December, Elisa survived a home invasion attack while staying at an Airbnb in San Fernando Valley. Two men reportedly entered her friends’ accommodations and began threatening the 10 people who were staying there, reportedly holding them at gunpoint. Text “RICKEY” to 71007 to join the Rickey Smiley Morning Show mobile club for exclusive news.  ( Terms and conditions ). View this post on Instagram As women we tend to be very hard on ourselves. Months ago, I escaped from a home invasion and in the process I was left with intense scaring on my stomach. Until now I’ve been so afraid to show these scars, and incredibly insecure about the way I look. But I now realize these scars are a part of my journey, and tell the story of who I am. I love my body, and I am proud to be in the place I am today. #selfhealing A post shared by Elisa J. (@elisajohnson) on Apr 24, 2019 at 12:54pm PDT   Elisa, who reportedly heard the noise from her bedroom, was able to escape through a sliding glass door — but not without any injuries, apparently. She took to Instagram to reveal scars wrapped around her stomach. She captioned the photo: “As women we tend to be very hard on ourselves. Months ago, I escaped from a home invasion and in the process I was left with intense scaring on my stomach. Until now I’ve been so afraid to show these scars, and incredibly insecure about the way I look. But I now realize these scars are a part of my journey, and tell the story of who I am. I love my body, and I am proud to be in the place I am today.” This is SUCH a scary situation to go through. We know Magic and Cookie are keeping their baby girl close. SOURCE: Bossip.com Sign Up For Our Newsletter! Close Thank you for subscribing! Please be sure to open and click your first newsletter so we can confirm your subscription. Email Submit ALSO TRENDING ON RICKEYSMILEYMORNINGSHOW.COM : K. Michelle’s Surrogate Confirms She’s Carrying Twins [VIDEO] Magic Johnson Steps Down From Job As Lakers President Of Basketball Operations Atlanta News Anchor Goes Off To Beyonce’s ‘Before I Let Go’ [VIDEO] Follow @TheRSMS

Magic Johnson’s Daughter, Elisa, Left With “Intense Scarring” On Her Stomach After Airbnb Home Invasion [PHOTO]

→ Leave a comment

Posted in Celebrities, Hollywood, Hot Stuff, News

Tagged , , , , , , , , , , , , ,

A SKIN-depth Look at the Sex and Nudity of Comic Book Movies

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

This week, the king of all comic book movies, Avengers: Endgame, is in theaters, and though the Marvel movies have been an entirely skinless affair—for the female characters, at least—there’s been no shortage of great nudity in comic book movies over the years. … read more

Originally posted here:
A SKIN-depth Look at the Sex and Nudity of Comic Book Movies

→ Leave a comment

Posted in Celebrities, Hot Stuff, Sex

Tagged , , , , , , , , ,

Crackhead in a Store and Other Videos of the Day

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

Drunk Man on the Hood… Drunk Man Run Over Throwback Treadmill Runner Loses Pants Interesting Brazlian Shooting instructor Pro Lifers Should be Beat The post Crackhead in a Store and Other Videos of the Day appeared first on DrunkenStepFather.com .

Original post:
Crackhead in a Store and Other Videos of the Day

→ Leave a comment

Posted in Hot Stuff, Sex

Tagged , , , , , , , , , , ,

Skin Links 4.26.19

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

A Field Guide to Gwyneth Paltrow Ashanti in a See Through Dress and Panty Flash! Grab Some Sex Wax and Buff Your Board to Kamila Joanna Thank God Jenessa Dawn is a Country Girl Tessa Fowler is Jiggly in a Pool! Valmont Barcelona Bridal Fashion Week Will Have Everyone Wanting to Bang the Bride Twenty Questions with Hot Porn Starlet Sophia Lux … read more

Excerpt from:
Skin Links 4.26.19

→ Leave a comment

Posted in Celebrities, Hot Stuff, Sex

Tagged , , , , , , , , , , ,

We’re NOT WORTHY: Beyoncé Lays Her Edges On The Gram, Snatches Ours With New Bootylicious Adidas Pics

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

Source: Kevin Mazur / Getty Beyonce Teases Adidas Collab Beyoncè just doesn’t get tired of putting her foot on our necks. After blessing us with a Netflix film, a Homecoming, a new anthem and a dance challenge all in one week, the Queen decided to grace us with new Instagram pics, a video and some captions to go along with them. View this post on Instagram Oohweebeebeefreakydeakythinkmeseeshepinkbikinirockthatkufidyethatshikinefertitiedgeskinky A post shared by Beyoncé (@beyonce) on Apr 26, 2019 at 8:58am PDT   News broke earlier this month that Bey will be teaming up with Adidas i n a collaboration that will produce signature shoes, clothing and re-launch the singer’s athleisure brand, Ivy Park. The mom of three teases her new partnership in with her new IG pics, rocking an Adidas tracksuit while showing off her lit sneaker collection and legendary legs at the same damn time. View this post on Instagram A post shared by Beyoncé (@beyonce) on Apr 26, 2019 at 8:56am PDT   Come through, Queen! View this post on Instagram A post shared by Beyoncé (@beyonce) on Apr 26, 2019 at 8:58am PDT   We stan an iconic Queen doing regular folk things.    

The rest is here:
We’re NOT WORTHY: Beyoncé Lays Her Edges On The Gram, Snatches Ours With New Bootylicious Adidas Pics

→ Leave a comment

Posted in Celebrities, Hollywood, Hot Stuff

Tagged , , , , , , , , , , , , ,

The Battle of Winterfell: New Game of Thrones Theory Has Fans Prematurely Outraged

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

Hey, was last week’s episode of Game of Thrones a little too slow for you?  Maybe you could’ve done with a little less reminiscing and goblet-sipping, and a little more of the sex and swordplay the show is famous for. Well if that’s the case, you’re in luck. Sunday night’s episode is certain to traumatize viewers for life with the deaths of several key characters. We’ve already discussed the various theories and who will die, and the consensus seems to be that some of GoT’s most badass warriors will be struck down at the Battle of Winterfell. (That’s also rumored to the episode title, although HBO is keeping that information under wraps again this week.) It’s not looking good for Brienne of Tarth, who basically competed her character arc by becoming a knight of the Seven Kingdoms. Similarly, Grey Worm fantasized about taking a relaxing vacation with Missandei, which is basically the Westeros equivalent of a cop fanstasizing about his upcoming retirement in an ’80s action movie. Even Arya’s not safe, as her sex scene with Gendry puts her at an increased risk for joining the Night’s Army. (Anyone who’s ever seen a horror movie knows that teens who lose their virginity are that much more likely to be dispatched in gory fashion shortly thereafter.) Of course, if Game of Thrones is anything, it’s unpredictable. The show has trafficked in shocking twists ever since the day Ned Stark lost his head playing politics in King’s Landing. So attempting to predict how the final four episodes will play out is a bit like trying to guess the subject of Trump’s next all-caps tweet tirade. Even the Three-Eyed Raven doesn’t know what goes in on inside that skull. So perhaps all of the brave warriors who fans have marked for death will still be standing at the end of the battle. And maybe the Night King will target a more vulnerable group. As you probably recall, Bran, Tyrion, Sam, and others who have been deemed unfit for battle will be hiding in the crypts below Winterfell. It’s a bad sign that multiple characters felt the need to proclaim how safe the crypts are in what might turn out to be a bit of heavy-handed foreshadowing. It’s an even worse sign that  Yes, if you spend much time in the GoT-obsessed corners of the internet, then by now, you’ve probably heard multiple theories about the Night King making a beeline for Bran and the rest of the crypt keepers. The most obvious hypothesis is that meme-able mic dropper will raise the dead and use them to help wage war against the defenseless. But there are other possibilities as well. Some believe NK was a Stark in life and that he’ll be drawn to the crypts for different reasons. Perhaps to retrieve Rhaegar Targaryen’s legendary harp, which might confer some sort of magical properties to the carrier, or might somehow be used to confrim Jon Snow’s true identity. Others believe the Night King is Rhaegar — though that seems unlikely given what we’ve already seen of his origin story. (Though it’s worth noting that while the show suggests the Children of the Forest created the White Walkers centuries before the main action of GoT, this may not be the case.) In any event, GoT S8E3 is sure to feature some epic warfare. In fact, it’s rumored that we’ll be seeing the longest battle sequence in the history of film or television. But it also promises much more than that — plot twists and character deaths that will set the stage for the final three episodes and the conclusion of the series. Aegon Targaryen himself, Kit Harington, has gone on record as saying that no one he’s spoken to yet has correctly predicted the ending. So we’ll hold off on even trying. Instead we’ll be here imagining how wild it would be if the the Walkers somehow emerged victorious. Would be cool to see, but the remaining episodes would probably get pretty boring with no dialogue. View Slideshow: Game of Thrones: Who’s About to Die!? [Unofficial Rankings By Unofficial Odds]

Read more:
The Battle of Winterfell: New Game of Thrones Theory Has Fans Prematurely Outraged

→ Leave a comment

Posted in Celebrities, Gossip

Tagged , , , , , , , ,

R. Kelly Loses Underage Sex Civil Lawsuit Judgment After Skipping Court

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

Source: Nuccio DiNuzzo / Getty R. Kelly lost a judgment in a civil lawsuit case after failing to appear in court in Chicago this week. The woman who brought the lawsuit claims that the troubled R&B singer engaged in sexual activity with her when she was 16 years of age. The Guardian reports : The woman, who accused Kelly of repeatedly having sex with her when she was 16, filed the case in Chicago in February, a day before Kelly was arrested on 10 charges of sexual abuse. She is one of four accusers – three of whom were under age at the time of the alleged crimes – at the center of the criminal case against Kelly, according to her lawyer, Jeffrey Deutschman. She is identified as “HW” in criminal court filings. A Chicago judge on Tuesday entered a default ruling against Kelly, according to court records, after he did not respond to the lawsuit and missed the hearing. The judge, Moira Johnson, will hear from the woman at a hearing next month before determining how much Kelly should pay in damages. Kelly’s criminal defense attorney, Steve Greenberg, said he was not involved in the civil litigation and declined to comment. According to the report, Kelly and the unnamed woman engaged in sex for over the course of a year. — Photo:

Read the rest here:
R. Kelly Loses Underage Sex Civil Lawsuit Judgment After Skipping Court

→ Leave a comment

Posted in Celebrities, Gossip, Hollywood, Music

Tagged , , , , , , , , , , , ,

Snoop Dogg to Appear on ‘Law & Order: SVU’ Episode

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

Read more:

Source: Jason G. Bahr / Getty Snoop Dogg is putting his acting chops to work and will appear on an upcoming episode of ‘Law & Order: Special Victims Unit.’ Join Our Text Club To Get The Latest Music, Entertainment, Contests And Breaking News On Your Phone. Text BALTIMORE to 24042 to join! Ice-T, who plays sergeant Fin Tutuola on the show, announced the Doggfather’s guest appearance last month on social media. Fin, along with Olivia Benson and the others, will investigate the public feud between two men after a pop star is assaulted in her home. Appropriately, Snoop plays the role of a recording artist who’s engaged in a public feud with the husband of the pop star. Meanwhile, Fin’s family ties to one of the men causes trouble. We’ll get to see how it all played out on Thursday (May 2). Check out the full episode trailer below. Law and Order SVU 20×22 @SnoopDogg guest star. pic.twitter.com/CHj5MJzie2 — Law and Order SVU (@LawandOrderSVU1) April 26, 2019 [ione_media_gallery src=”https://92q.com” id=”3903422″ overlay=”true”]

Snoop Dogg to Appear on ‘Law & Order: SVU’ Episode

→ Leave a comment

Posted in Celebrities, Hollywood, Hot Stuff, News

Tagged , , , , , , , , , , , , , ,

Ashanti Tits of the Day

Posted on April 26, 2019 by Benny Hollywood| Leave a comment

I originally had these these Ashanti big girl tits in a see through outfit cued over 10 days ago… I didn’t notice it in my DRAFT posts for obvious reasons…. No not race related reasons. I love black girls… I just don’t love what Ashanti has done with herself…not that I remember her for being a hot popstar many years ago…but I do know she didn’t look like this and I am not quite sure what this is…maybe a Halloween Costume, some clown costume cuz she’s working kid’s birthday parties to pay the mortgage….you know that celeb life gets expensive! TO SEE THE REST OF THE PICS CLICK HERE JOIN THE NEWSLETTER YOU ASSHOLES! The post Ashanti Tits of the Day appeared first on DrunkenStepFather.com .

Original post:
Ashanti Tits of the Day

→ Leave a comment

Posted in Hot Stuff, Sex

Tagged , , , , , , , , , ,